] ] notifCount = parseInt($(this).html()) + notifCount; { var key = e.keyCode; ] { Auch unter Mein Vodafone ist keine Guthabenabfrage möglich. { ] LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_0","componentSelector":"#lineardisplaymessageviewwrapper_0","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":1663279,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. "initiatorDataMatcher" : "data-lia-kudos-id" } "disallowZeroCount" : "false", ] "truncateBodyRetainsHtml" : "false", LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1664055 .lia-rating-control-passive', '#form_2'); "context" : "envParam:quiltName,message,product,contextId,contextUrl", { LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_2","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_2","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/Archiv_CallYa/thread-id/46357","ajaxErrorEventName":"LITHIUM:ajaxError","token":"k6kCH5BU2aaKWN3DCe_yuNgSxiGDxOpy8H64szhlOqw. ] { // Oops. { { '; { { { return; "action" : "rerender" "event" : "removeMessageUserEmailSubscription", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_17","feedbackSelector":".InfoMessage"}); { "action" : "rerender" "action" : "rerender" "ajaxEvent" : "LITHIUM:lightboxRenderComponent", LITHIUM.Auth.CHECK_SESSION_TOKEN = 'jdgvC-67bob6nnP7-OtKeXE7iLwcXaVc3UfZIjCPvvM. LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_6","menuItemsSelector":".lia-menu-dropdown-items"}}); "actions" : [ "action" : "rerender" { "action" : "rerender" ] "actions" : [ "kudosable" : "true", ] "useCountToKudo" : "false", { }, LITHIUM.StarRating('#any_4', false, 1, 'LITHIUM:starRating'); ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); })(LITHIUM.jQuery); { "event" : "MessagesWidgetMessageEdit", "action" : "rerender" "action" : "rerender" { } } else { "actions" : [ "useSimpleView" : "false", "action" : "rerender" ] "action" : "rerender" 208 ... Guthaben soll bis Ende nächster Woche aufgeladen sein. LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_2","feedbackSelector":".InfoMessage"}); // We made it! { "kudosable" : "true", "selector" : "#messageview_3", ] ] "linkDisabled" : "false" { } "kudosLinksDisabled" : "false", "context" : "envParam:quiltName,product,contextId,contextUrl", "linkDisabled" : "false" "quiltName" : "ForumMessage", "event" : "MessagesWidgetEditAnswerForm", { "actions" : [ $(event.data.selector).removeClass('cssmenu-open'); { }, "actions" : [ "action" : "rerender" LITHIUM.AutoComplete({"options":{"triggerTextLength":0,"updateInputOnSelect":true,"loadingText":"Suche läuft...","emptyText":"Keine Treffer","successText":"Ergebnisse:","defaultText":"Suchbegriff eingeben","disabled":false,"footerContent":[{"scripts":"\n\n;(function($){LITHIUM.Link=function(params){var $doc=$(document);function handler(event){var $link=$(this);var token=$link.data('lia-action-token');if($link.data('lia-ajax')!==true&&token!==undefined){if(event.isPropagationStopped()===false&&event.isImmediatePropagationStopped()===false&&event.isDefaultPrevented()===false){event.stop();var $form=$('',{method:'POST',action:$link.attr('href'),enctype:'multipart/form-data'});var $ticket=$('',{type:'hidden',name:'lia-action-token',value:token});$form.append($ticket);$(document.body).append($form);$form.submit();$doc.trigger('click');}}}\nif($doc.data('lia-link-action-handler')===undefined){$doc.data('lia-link-action-handler',true);$doc.on('click.link-action',params.linkSelector,handler);$.fn.on=$.wrap($.fn.on,function(proceed){var ret=proceed.apply(this,$.makeArray(arguments).slice(1));if(this.is(document)){$doc.off('click.link-action',params.linkSelector,handler);proceed.call(this,'click.link-action',params.linkSelector,handler);}\nreturn ret;});}}})(LITHIUM.jQuery);\r\n\nLITHIUM.Link({\n \"linkSelector\" : \"a.lia-link-ticket-post-action\"\n});LITHIUM.AjaxSupport.fromLink('#disableAutoComplete_65b55ddce4678e', 'disableAutoComplete', '#ajaxfeedback_65b55ddbb195d5_0', 'LITHIUM:ajaxError', {}, '3afDW3SJon96jnXnylPTo2iDTKt1uObcY8-KDc45l1M. LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_32","feedbackSelector":".InfoMessage"}); { ;(function($) { "action" : "rerender" "event" : "QuickReply", }); { }); "actions" : [ } "context" : "envParam:quiltName", "action" : "rerender" return; "linkDisabled" : "false" "action" : "rerender" } ', 'ajax'); } "action" : "rerender" })(LITHIUM.jQuery); { "actions" : [ "useCountToKudo" : "false", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", ] ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); }, if ( key == neededkeys[0] ) { if ( !watching ) { LITHIUM.AjaxSupport.fromLink('#enableAutoComplete_65b55ddbb195d5', 'enableAutoComplete', '#ajaxfeedback_65b55ddbb195d5_0', 'LITHIUM:ajaxError', {}, 'Qf-iE_7VUlv9OZJUSmpXjzoWcb57VQh63or6tjJ0nOA. }, "actions" : [ { // console.log(key); ], "context" : "", "actions" : [ { { "context" : "", "action" : "rerender" "displaySubject" : "true", "context" : "", "parameters" : { "useSubjectIcons" : "true", LITHIUM.AjaxSupport.fromLink('#kudoEntity_4', 'kudoEntity', '#ajaxfeedback_4', 'LITHIUM:ajaxError', {}, 'HjqKq0wSVDimNQSkTNGpeEsVVwzuhq3QDv50yQJdLAE. "event" : "ProductAnswer", "linkDisabled" : "false" "context" : "", "action" : "rerender" "quiltName" : "ForumMessage", "revokeMode" : "true", "context" : "lia-deleted-state", "event" : "MessagesWidgetEditCommentForm", { }, "context" : "", { ], Da hilft nur eins - aufladen. "}); "action" : "rerender" "context" : "", "kudosable" : "true", "context" : "lia-deleted-state", "action" : "rerender" "actions" : [ "action" : "rerender" "action" : "rerender" }, "event" : "MessagesWidgetEditAnswerForm", { // console.log('watching: ' + key); return; "context" : "lia-deleted-state", "context" : "envParam:selectedMessage", "forceSearchRequestParameterForBlurbBuilder" : "false", "actions" : [ var clickHandler = function(event) { "context" : "", LITHIUM.InputEditForm("form_5", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. "actions" : [ "action" : "rerender" "disableKudosForAnonUser" : "false", "event" : "MessagesWidgetEditAnswerForm", "messageViewOptions" : "1111110111111111111110111110100101001101" } "truncateBody" : "true", "context" : "envParam:feedbackData", "context" : "", } "action" : "rerender" LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_1","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_1","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/Archiv_CallYa/thread-id/46357","ajaxErrorEventName":"LITHIUM:ajaxError","token":"ODMrKUwHA9yGBBZwolrWCOIs2oQAAnvAtgEVqeGYVOM. "actions" : [ ] "eventActions" : [ "actions" : [ "context" : "envParam:quiltName", "componentId" : "forums.widget.message-view", { // We're good so far. "activecastFullscreen" : false, LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_20","feedbackSelector":".InfoMessage"}); "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", } } { "linkDisabled" : "false" } "kudosable" : "true", }); LITHIUM.StarRating('#any_3', false, 1, 'LITHIUM:starRating'); "}); "includeRepliesModerationState" : "false", "disableKudosForAnonUser" : "false", { ', 'ajax'); "}); LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_28","feedbackSelector":".InfoMessage"}); LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_19","feedbackSelector":".InfoMessage"}); "actions" : [ "actions" : [ "disallowZeroCount" : "false", { "actions" : [ "event" : "MessagesWidgetAnswerForm", ] "actions" : [ "componentId" : "forums.widget.message-view", "action" : "rerender" LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_5","menuItemsSelector":".lia-menu-dropdown-items"}}); { LITHIUM.Loader.runJsAttached(); "actions" : [ "forceSearchRequestParameterForBlurbBuilder" : "false", "event" : "removeMessageUserEmailSubscription", "actions" : [ "actions" : [ }, // just for convenience, you need a login anyways... Betreff: Guthaben aufgeladen.. wird aber nicht angezeigt. }, "kudosLinksDisabled" : "false", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", { var notifCount = 0; "action" : "rerender" "useSimpleView" : "false", } "event" : "MessagesWidgetAnswerForm", } }, LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_25","feedbackSelector":".InfoMessage"}); }); "showCountOnly" : "false", ] "useSubjectIcons" : "true", { LITHIUM.InputEditForm("form_0", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. "action" : "rerender" }, } "event" : "unapproveMessage", "context" : "", }, "event" : "MessagesWidgetAnswerForm", "action" : "rerender" "context" : "envParam:quiltName,expandedQuiltName", }); "messageViewOptions" : "1111110111111111111110111110100101011101" }, ], "linkDisabled" : "false" "event" : "MessagesWidgetEditAnswerForm", { if ( key == neededkeys[0] ) { "event" : "MessagesWidgetCommentForm", "context" : "", ] ] "parameters" : { "actions" : [ }, }, "displayStyle" : "horizontal", "actions" : [ "disallowZeroCount" : "false", { "context" : "", "action" : "rerender" })(LITHIUM.jQuery); // Pull in global jQuery reference { { { } "actions" : [ { "context" : "", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_31","feedbackSelector":".InfoMessage"}); "parameters" : { { window.location.replace('/t5/user/userloginpage'); ', 'ajax'); "actions" : [ ] { } "context" : "lia-deleted-state", LITHIUM.MessageBodyDisplay('#bodyDisplay_5', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); } { "selector" : "#kudosButtonV2_3", ], "initiatorBinding" : true, { "actions" : [ { var neededkeys = [76, 79, 71, 77, 69, 73, 78]; "context" : "envParam:feedbackData", }, { "event" : "ProductAnswerComment", "event" : "RevokeSolutionAction", "disableKudosForAnonUser" : "false", "parameters" : { "action" : "rerender" "action" : "rerender" } { "eventActions" : [ }, $(document).keydown(function(e) { "actions" : [ "truncateBody" : "true", "displaySubject" : "true", "actions" : [ } "actions" : [ "disableLinks" : "false", ] ;(function($) { "messageViewOptions" : "1111110111111111111110111110100101001101" "action" : "rerender" "disableKudosForAnonUser" : "false", { "disallowZeroCount" : "false", "event" : "ProductMessageEdit", "context" : "", "actions" : [ ] ] "context" : "envParam:quiltName,product,contextId,contextUrl", "event" : "QuickReply", "event" : "QuickReply", }, ', 'ajax');","content":"Vorschläge deaktivieren"}],"prefixTriggerTextLength":3},"inputSelector":"#messageSearchField_65b55ddbb195d5_1","redirectToItemLink":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.searchform.tkbmessagesearchfield.messagesearchfield:autocomplete?t:ac=board-id/Archiv_CallYa/thread-id/46357&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"}); "useTruncatedSubject" : "true", "actions" : [ } } "showCountOnly" : "false", }, "action" : "rerender" { LITHIUM.ValueSurveyLauncher({"detectPopUpCSS":".lia-dialog-open","dialogLinkSelector":"#valueSurveyLauncher","launchDelay":233994}); Lieferanten-Buchhaltung / Accounts Payable, Vorschläge deaktivieren"}],"prefixTriggerTextLength":3},"inputSelector":"#messageSearchField_65b55ddbb195d5_0","redirectToItemLink":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.searchform.messagesearchfield.messagesearchfield:autocomplete?t:ac=board-id/Archiv_CallYa/thread-id/46357&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"}); $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); }, ] "event" : "addThreadUserEmailSubscription", "action" : "rerender" ] "event" : "removeMessageUserEmailSubscription", "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "action" : "rerender" { "disallowZeroCount" : "false", "action" : "pulsate" "context" : "", if ( key == neededkeys[0] ) { "parameters" : { { ] ] if ( count == neededkeys.length ) { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_21","feedbackSelector":".InfoMessage"}); })(LITHIUM.jQuery); "action" : "pulsate" { "action" : "rerender" ', 'ajax'); "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "actions" : [ "initiatorBinding" : true, } "event" : "RevokeSolutionAction", var keycodes = { "context" : "", })(LITHIUM.jQuery); "action" : "rerender" }, } }, watching = false; "forceSearchRequestParameterForBlurbBuilder" : "false", { Damit ist die Zeitspanne gemeint, in der kein Verbrauch des Guthabens verzeichnet wird. ] { ] window.NREUM||(NREUM={});NREUM.info={"errorBeacon":"bam-cell.nr-data.net","licenseKey":"90ec53e80f","agent":"","beacon":"bam-cell.nr-data.net","applicationTime":1034,"applicationID":"309530949","transactionName":"M1BRYEAEWBVYURYLWAoaZFFQSmIHSVcRFkUdZVJTV19wCUtHDzZYFFxQZFMCUw==","queueTime":0,"atts":"HxdGFggeFA1afA0GUjBMQ1EQXxQAVkAXDxoGWlJGVkcaREtXBAdFAUcRDhANQhJJQVg+GDgaVVtAEFtIT10GA1ELW1YaVgBqSU0HPk12FlZbXURIdQdVXjsDa0tyRkBaBFQDVx8DF1EDUF9VVgBYS05bEAYaBVdWRh8LXwVRRk8DWQNQSVFbAkI6FkYGT0c4GgICBFYEVg0QTkBRFlReUXsBFFwIAFBTBFYNBwIFUQZKG1kBN0QBR3pQEF8bVxUQCQFnBVJWelMIU0QDECQNRRFYZ1tCDFU2WFUHQBtGXlB5XQdfClwQWEBDFkBWFh5HXQV7XRZADUZTUlhBABRKG1kBNk9GDxEHU1AEBwgFAE9UAQ1WGQZUVVAUClsGDkkFVwdTBlReXwFRAAVGGRFfUStZAlx7BkANRnRBV1oMQDl6Uw4ObgUXHxZZBmQDSkY0UGYRUEFNEF8UNXx+JyFjRFxXFHQ3eSsZXwcRRAVSVkcSMn4ja3dCFlgUXFAaWwELWRl+Ky9+MBUMFk8Y"}, \n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; ] watching = false; "actions" : [ LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1664055 .lia-rating-control-passive', '#form_2'); { "context" : "envParam:selectedMessage", { }, "context" : "envParam:feedbackData", ‎15.05.2018 23:17 Ich habe heute einmal 15 via Sofortüberweisung aufgeladen (welche mir auch via Mail und SMS auf die Rufnummer angezeigt worden ist) leider interesiert es die Callya Flex App mal garnicht. "initiatorBinding" : true, LITHIUM.Auth.API_URL = '/t5/util/authcheckpage'; "context" : "", }, Du musst nur die gewünschte Rufnummer eingeben und schon wird das Guthaben mit dem Betrag deiner Wahl aufgeladen. { ] { } "context" : "envParam:entity", "selector" : "#messageview_5", { { }, // Reset the conditions so that someone can do it all again. "actions" : [ "event" : "MessagesWidgetCommentForm", { "initiatorBinding" : true, } "action" : "rerender" } ] ","loaderSelector":"#lineardisplaymessageviewwrapper_3 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); LITHIUM.AjaxSupport.fromForm('#form_4', 'GiveRating', '#ajaxfeedback_4', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); "selector" : "#messageview_2", "event" : "ProductAnswerComment", $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); "messageViewOptions" : "1111110111111111111110111110100101001101" $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); ] } }, ] "event" : "editProductMessage", "defaultAriaLabel" : "", } "action" : "rerender" ] var neededkeys = [76, 79, 71, 77, 69, 73, 78]; "parameters" : { "event" : "ProductAnswer", "action" : "rerender" "action" : "rerender" ] LITHIUM.Auth.CHECK_SESSION_TOKEN = 'jdgvC-67bob6nnP7-OtKeXE7iLwcXaVc3UfZIjCPvvM. "action" : "rerender" } "useCountToKudo" : "false", { }, "disallowZeroCount" : "false", }, { count = 0; LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_2","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_2","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/Archiv_CallYa/thread-id/46357","ajaxErrorEventName":"LITHIUM:ajaxError","token":"k6kCH5BU2aaKWN3DCe_yuNgSxiGDxOpy8H64szhlOqw. "event" : "kudoEntity", LITHIUM.AjaxSupport.ComponentEvents.set({ } "action" : "rerender" { }, "event" : "markAsSpamWithoutRedirect", } ] LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_4","componentSelector":"#lineardisplaymessageviewwrapper_4","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":1664101,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. Dies ist aber behoben und Du solltest alles angezeigt bekommen. "actions" : [ "event" : "addMessageUserEmailSubscription", "componentId" : "kudos.widget.button", } "context" : "", "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", })(LITHIUM.jQuery); }, "actions" : [ }, "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", }, ;(function($) { { } "disableLabelLinks" : "false", "action" : "rerender" }, "context" : "envParam:quiltName,message", "event" : "MessagesWidgetMessageEdit", }, } }); "event" : "expandMessage", { { "context" : "envParam:quiltName,message,product,contextId,contextUrl", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "event" : "removeThreadUserEmailSubscription", { LITHIUM.AjaxSupport.fromForm('#form_4', 'GiveRating', '#ajaxfeedback_4', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); "action" : "rerender" $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); { "event" : "markAsSpamWithoutRedirect", { document.cookie=escape(cookieName) + "=" + cookieValue + ";domain=" + cookieDomain + ";path=/;expires=" + expireDate.toUTCString(); "action" : "rerender" LITHIUM.AjaxSupport.ComponentEvents.set({ "context" : "envParam:quiltName,expandedQuiltName", "action" : "rerender" "action" : "rerender" } // We're good so far. } }); } "actions" : [

Finanzamt Essen öffnungszeiten, Gelateria Di Berna Lieferung, Hotel ötztal Mit Pool, Hotel Bergkristall Silbertal Speisekarte, Lebenslauf Vorlage Schweiz Schüler, Anwalt Für Rumänisches Recht, Chinese Schwandorf Lieferservice, Studentenwohnheim Berlin Gesundbrunnen, Zu Früh Wach Sprüche, Ehrlich Brothers Fabrik Der Träume Corona, Windows 10 Insider Preview 20h1, Hotel Villa Toskana Parsberg,

Kategorien: Startseite

Schreibe einen Kommentar

Deine E-Mail-Adresse wird nicht veröffentlicht. Erforderliche Felder sind mit * markiert.