"context" : "", } }, "event" : "MessagesWidgetCommentForm", "context" : "", ] LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1882614 .lia-rating-control-passive', '#form'); Falls das Guthaben auf Deinem CallYa-Konto mal nicht für den Preis des Tarifs oder der Optionen reicht, werden wieder 20 Euro per SEPA-Lastschriftverfahren auf Dein CallYa-Konto gebucht. { { // Oops, not the right sequence, lets restart from the top. "actions" : [ "actions" : [ ] "eventActions" : [ }, ] ] { Gehe in die „Ein­stel­lun­gen”, tippe auf „WLAN” und prüfe, ob Du eine Inter­netverbindung hast. { }, { "action" : "rerender" "event" : "deleteMessage", "event" : "removeMessageUserEmailSubscription", } "actions" : [ "event" : "addMessageUserEmailSubscription", "action" : "rerender" }); } } "eventActions" : [ ] }, { "eventActions" : [ "showCountOnly" : "false", "action" : "rerender" "action" : "rerender" "quiltName" : "ForumMessage", "context" : "", }, "actions" : [ }, "linkDisabled" : "false" "disallowZeroCount" : "false", "}); "initiatorDataMatcher" : "data-lia-message-uid" "action" : "rerender" "selector" : "#kudosButtonV2_7", LITHIUM.AjaxSupport.fromForm('#form_6', 'GiveRating', '#ajaxfeedback_6', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); "selector" : "#messageview_4", "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", LITHIUM.ValueSurveyLauncher({"detectPopUpCSS":".lia-dialog-open","dialogLinkSelector":"#valueSurveyLauncher","launchDelay":232828}); "actions" : [ LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_0","menuItemsSelector":".lia-menu-dropdown-items"}}); { ;(function($) { "event" : "kudoEntity", LITHIUM.MessageBodyDisplay('#bodyDisplay_2', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); }, "actions" : [ "context" : "envParam:quiltName,product,contextId,contextUrl", }, "parameters" : { "context" : "", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_29","feedbackSelector":".InfoMessage"}); { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "action" : "rerender" LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_28","feedbackSelector":".InfoMessage"}); "action" : "pulsate" }); LITHIUM.StarRating('#any_5', false, 1, 'LITHIUM:starRating'); { "action" : "rerender" "context" : "envParam:quiltName,message", { { "kudosLinksDisabled" : "false", "useSimpleView" : "false", "messageViewOptions" : "1111110111111111111110111110100101001101" }, } "action" : "rerender" { { }, }, window.location.replace('/t5/user/userloginpage'); "actions" : [ } { LITHIUM.AutoComplete({"options":{"triggerTextLength":0,"updateInputOnSelect":true,"loadingText":"Suche nach Benutzern läuft...","emptyText":"Keine Treffer","successText":"Gefundene Benutzer:","defaultText":"Benutzernamen oder Rang eingeben","disabled":false,"footerContent":[{"scripts":"\n\n;(function($){LITHIUM.Link=function(params){var $doc=$(document);function handler(event){var $link=$(this);var token=$link.data('lia-action-token');if($link.data('lia-ajax')!==true&&token!==undefined){if(event.isPropagationStopped()===false&&event.isImmediatePropagationStopped()===false&&event.isDefaultPrevented()===false){event.stop();var $form=$(', Vorschläge deaktivieren"}],"prefixTriggerTextLength":0},"inputSelector":"#userSearchField_2db5ff08954165","redirectToItemLink":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.searchform.usersearchfield.usersearchfield:autocomplete?t:ac=board-id/Archiv_CallYa/thread-id/58429&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"}); LITHIUM.Dialog.options['2017907831'] = {"contentContext":"valuesurveys.widget.survey-prompt-dialog","dialogOptions":{"minHeight":399,"draggable":false,"maxHeight":800,"resizable":false,"autoOpen":false,"width":610,"minWidth":610,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modal-simple lia-panel-dialog-modal-valuesurvey","position":["center","center"],"modal":true,"maxWidth":610,"ariaLabel":"Feedback for community"},"contentType":"ajax"}; { "eventActions" : [ } { "action" : "rerender" "eventActions" : [ "action" : "rerender" "event" : "AcceptSolutionAction", "actions" : [ "event" : "removeMessageUserEmailSubscription", { Nachdem ich neu aufgeladen habe, ist die Internet-Flatrate weiter aktiv. Das kann passieren, wenn Du einen neuen Red-Tarif oder Red+ hast und die MeinVodafone-App beim ersten Mal über WLAN aufgerufen hast. "context" : "", }, "actions" : [ "useSubjectIcons" : "true", { ] "useSubjectIcons" : "true", { ] "action" : "rerender" LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_6","componentSelector":"#lineardisplaymessageviewwrapper_6","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":1912290,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. $(event.data.selector).addClass('cssmenu-open') } "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", }, { } "useCountToKudo" : "false", "event" : "addMessageUserEmailSubscription", { "context" : "", "event" : "QuickReply", "showCountOnly" : "false", "event" : "MessagesWidgetEditCommentForm", var topicIdCustomAnnouncement = clickedDomElement.data("message-id"); } "componentId" : "forums.widget.message-view", "event" : "removeThreadUserEmailSubscription", "componentId" : "forums.widget.message-view", "context" : "", { { ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); "actions" : [ ] "event" : "ProductMessageEdit", "disallowZeroCount" : "false", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", ] "action" : "rerender" } "parameters" : { var keycodes = { watching = true; "parameters" : { { "eventActions" : [ .attr('aria-expanded','true'); "context" : "envParam:quiltName,expandedQuiltName", ] ","loaderSelector":"#lineardisplaymessageviewwrapper_3 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); ], LITHIUM.Dialog.options['-1722820519'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; "showCountOnly" : "false", { { }, } "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", { ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); }, ] "context" : "", "disallowZeroCount" : "false", $('.js-close-header-announcement').on('click', clickHandler); { if ( key == neededkeys[0] ) { }, { }, ] "action" : "rerender" LITHIUM.AjaxSupport.ComponentEvents.set({ "kudosLinksDisabled" : "false", } "actions" : [ }, "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "showCountOnly" : "false", $('.menu-container').on('click','.community-node-menu-btn.active', {'selector' : '.css-node-menu' }, handleClose); { "event" : "MessagesWidgetEditAction", "context" : "envParam:quiltName", } { { ] "action" : "rerender" "actions" : [ "event" : "unapproveMessage", "initiatorDataMatcher" : "data-lia-message-uid" "event" : "approveMessage", "actions" : [ })(LITHIUM.jQuery); //$('#vodafone-community-header').css('display','block'); "initiatorDataMatcher" : "data-lia-message-uid" LITHIUM.Dialog.options['2017907831'] = {"contentContext":"valuesurveys.widget.survey-prompt-dialog","dialogOptions":{"minHeight":399,"draggable":false,"maxHeight":800,"resizable":false,"autoOpen":false,"width":610,"minWidth":610,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modal-simple lia-panel-dialog-modal-valuesurvey","position":["center","center"],"modal":true,"maxWidth":610,"ariaLabel":"Feedback for community"},"contentType":"ajax"}; "event" : "unapproveMessage", // just for convenience, you need a login anyways... window.location.replace('/t5/user/userloginpage'); ] "action" : "rerender" LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_4","menuItemsSelector":".lia-menu-dropdown-items"}}); "parameters" : { "event" : "MessagesWidgetAnswerForm", }, } { { { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", { "disableKudosForAnonUser" : "false", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_30","feedbackSelector":".InfoMessage"}); ] { : jetzt funktioniert es gottseidank wieder… ***** Update 18.7.17: Warum kann man nicht wie früher einfach mal SMS, Freiminuten und "disableLabelLinks" : "false", "useCountToKudo" : "false", }, "action" : "rerender" { "action" : "pulsate" } }); }, }, { "actions" : [ "actions" : [ "forceSearchRequestParameterForBlurbBuilder" : "false", ] { }); LITHIUM.AjaxSupport.fromForm('#form_5', 'GiveRating', '#ajaxfeedback_5', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); ] "context" : "lia-deleted-state", } LITHIUM.AjaxSupport.fromLink('#kudoEntity_1', 'kudoEntity', '#ajaxfeedback_1', 'LITHIUM:ajaxError', {}, 'iY7KdkX3nHs10nzK91HtHvhJWiCJZYI3-dn551mMs6A. }, "action" : "rerender" "actions" : [ "forceSearchRequestParameterForBlurbBuilder" : "false", { LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:lightboxRenderComponent","parameters":{"componentParams":"{\n \"surveyType\" : {\n \"value\" : \"communityexperience\",\n \"class\" : \"java.lang.String\"\n },\n \"surveyId\" : {\n \"value\" : \"3\",\n \"class\" : \"java.lang.Integer\"\n },\n \"triggerSelector\" : {\n \"value\" : \"#valueSurveyLauncher\",\n \"class\" : \"lithium.util.css.CssSelector\"\n }\n}","componentId":"valuesurveys.widget.survey-prompt-dialog"},"trackableEvent":false},"tokenId":"ajax","elementSelector":"#valueSurveyLauncher","action":"lightboxRenderComponent","feedbackSelector":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.liabase.basebody.valuesurveylauncher.valuesurveylauncher:lightboxrendercomponent?t:ac=board-id/Archiv_CallYa/thread-id/58429","ajaxErrorEventName":"LITHIUM:ajaxError","token":"xbTPUasNt1ZMUWlfDEx4VtL4wHh7XXE1d4MzY-MGUS4. "useSimpleView" : "false", ] } Bist du sicher, dass du fortfahren möchtest? { }, } "actions" : [ { "actions" : [ { "useSubjectIcons" : "true", "selector" : "#messageview", "kudosLinksDisabled" : "false", "displaySubject" : "true", "context" : "envParam:quiltName,expandedQuiltName", resetMenu(); "actions" : [ //$(window).scroll(function() { Wähl CallYa Komfort-Aufladung deaktivieren. "initiatorDataMatcher" : "data-lia-message-uid" } } "event" : "AcceptSolutionAction", "action" : "rerender" "context" : "", { "disableLabelLinks" : "false", "messageViewOptions" : "1111110111111111111110111110100101001101" }, "event" : "MessagesWidgetMessageEdit", "event" : "addThreadUserEmailSubscription", "disableLinks" : "false", "action" : "rerender" "useSimpleView" : "false", { "context" : "", } "action" : "rerender" "actions" : [ "event" : "editProductMessage", "quiltName" : "ForumMessage", }, { "useTruncatedSubject" : "true", $(document).ready(function() { "action" : "rerender" "action" : "pulsate" "actions" : [ "initiatorBinding" : true, "action" : "pulsate" "actions" : [ LITHIUM.AjaxSupport.ComponentEvents.set({ "context" : "envParam:quiltName,message,product,contextId,contextUrl", { }, ] LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_7","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_7","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/Archiv_CallYa/thread-id/58429","ajaxErrorEventName":"LITHIUM:ajaxError","token":"tOcGes1ZHkpdTE7Mj3LsLnxLCeYfH3QItLp2NkdktGI. ] "actions" : [ "actions" : [ { "action" : "rerender" "context" : "envParam:feedbackData", "action" : "rerender" { "action" : "rerender" var expireDate = new Date(); }, "context" : "", { if ( count == neededkeys.length ) { { "entity" : "1887589", "context" : "", }else{ "action" : "rerender" "actions" : [ } "event" : "ProductAnswer", $(event.data.selector).removeClass('cssmenu-open'); }, "disallowZeroCount" : "false", ] count = 0; "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "context" : "", { } { "initiatorDataMatcher" : "data-lia-message-uid" { { }, ] { ] { "action" : "pulsate" "context" : "envParam:quiltName,product,contextId,contextUrl", }, "useCountToKudo" : "false", { LITHIUM.InputEditForm("form_6", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. var notifCount = 0; })(LITHIUM.jQuery); "action" : "rerender" "disableKudosForAnonUser" : "false", $(document).ready(function(){ "event" : "QuickReply", "action" : "rerender" } { } "actions" : [ "showCountOnly" : "false", { "context" : "", } "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "context" : "envParam:quiltName,expandedQuiltName", "action" : "addClassName" } }, } ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); "context" : "", "initiatorDataMatcher" : "data-lia-kudos-id" }, { "context" : "envParam:entity", "actions" : [ Google Play: Guthaben kaufen. }, Wäh­le im Bere­ich „Back­ups” den Punkt „Back­up jet­zt erstellen”. }); { "context" : "envParam:quiltName,expandedQuiltName", "action" : "rerender" LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_3","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_3","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/Archiv_CallYa/thread-id/58429","ajaxErrorEventName":"LITHIUM:ajaxError","token":"76pWd5ARQWOlzL-hrS9pibwftz-stjoHh7lFmRDxkBo. LITHIUM.PartialRenderProxy({"limuirsComponentRenderedEvent":"LITHIUM:limuirsComponentRendered","relayEvent":"LITHIUM:partialRenderProxyRelay","listenerEvent":"LITHIUM:partialRenderProxy"}); { "event" : "ProductAnswerComment", } "actions" : [ "parameters" : { "kudosLinksDisabled" : "false", return; "context" : "envParam:entity", "eventActions" : [ { }); Falls Du einen VPN-Zugang ver­wen­d­est, kön­nte der Serv­er nicht erre­ich­bar sein; schalte hier­für Deine VPN-Verbindung kurzzeit­ig aus. "event" : "ProductAnswer", { "actions" : [ "actions" : [ "event" : "removeMessageUserEmailSubscription", }, { "initiatorDataMatcher" : "data-lia-kudos-id" }); "initiatorDataMatcher" : "data-lia-message-uid" "event" : "AcceptSolutionAction", LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_7","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_7","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/Archiv_CallYa/thread-id/58429","ajaxErrorEventName":"LITHIUM:ajaxError","token":"tOcGes1ZHkpdTE7Mj3LsLnxLCeYfH3QItLp2NkdktGI. } "actions" : [ ] }, { "event" : "MessagesWidgetEditCommentForm", "action" : "rerender" "actions" : [ "displaySubject" : "true", } "action" : "rerender" LITHIUM.AjaxSupport.fromLink('#kudoEntity', 'kudoEntity', '#ajaxfeedback', 'LITHIUM:ajaxError', {}, 'Igb9Goqiw6p0Ac3AeredVxzo0FJbpZTN2bk2SwniV0s. "action" : "rerender" "action" : "rerender" }, "ajaxEvent" : "LITHIUM:lightboxRenderComponent", "context" : "envParam:feedbackData", "disableLinks" : "false", } ] { "action" : "rerender" "event" : "MessagesWidgetEditCommentForm", ] "closeImageIconURL" : "https://forum.vodafone.de/skins/images/0F94F452D57A978C27D2D3E5195EDB37/responsive_peak/images/button_dialog_close.svg", }, { } "action" : "rerender" }, }, }); { }, "event" : "MessagesWidgetEditCommentForm", ] LITHIUM.InputEditForm("form_0", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. "action" : "rerender" }); "event" : "ProductAnswer", Aber es … { { Ob es sich tat­säch­lich um Server­prob­leme han­delt, kannst Du ein­fach auf der Sys­tem­sta­tus-Web­site von Apple über­prüfen. "context" : "", "forceSearchRequestParameterForBlurbBuilder" : "false", { "componentId" : "kudos.widget.button", "action" : "addClassName" "initiatorDataMatcher" : "data-lia-kudos-id" "action" : "rerender" "action" : "rerender" "actions" : [ { }, "event" : "ProductAnswerComment", ] }, "event" : "removeThreadUserEmailSubscription", }, } } }, { "activecastFullscreen" : false, "actions" : [ { LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_7","componentSelector":"#lineardisplaymessageviewwrapper_7","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":1912460,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. "actions" : [ { { "initiatorBinding" : true, { "displaySubject" : "true", "selector" : "#kudosButtonV2_4", "actions" : [ } ] { "event" : "addMessageUserEmailSubscription", $(this).toggleClass("view-btn-open view-btn-close"); "truncateBody" : "true", "selector" : "#kudosButtonV2_6", { } } }); { { "context" : "", }, "event" : "RevokeSolutionAction", "action" : "rerender" // If watching, pay attention to key presses, looking for right sequence. "event" : "addThreadUserEmailSubscription", { "quiltName" : "ForumMessage", "useSubjectIcons" : "true", "actions" : [ "event" : "removeMessageUserEmailSubscription", ] LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_39","feedbackSelector":".InfoMessage"}); } "event" : "MessagesWidgetCommentForm", ] "context" : "", "action" : "rerender" "action" : "rerender" "actions" : [ } "event" : "ProductMessageEdit", "event" : "addMessageUserEmailSubscription", "context" : "envParam:selectedMessage", { "context" : "", "linkDisabled" : "false" "eventActions" : [ ] } }); } } LITHIUM.AjaxSupport.ComponentEvents.set({ "actions" : [ "initiatorDataMatcher" : "data-lia-kudos-id" } LITHIUM.Dialog.options['585544627'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; ] }, "actions" : [ "action" : "rerender" ', 'ajax'); "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", { ] "action" : "rerender" "context" : "", setCookie: function(cookieName, cookieValue) { "disallowZeroCount" : "false", if ( key == neededkeys[0] ) {

13 Ssw Geschlecht Mädchen, Wikipedia Computer Geschichte, Harry Potter Veranstaltungen 2020, Schwarzsee Zermatt Bike, Marktblick Wernigerode Speisekarte, Woher Kommt Baklava, Lmu Geschichte Modulhandbuch, Eh Ludwigsburg Master Soziale Arbeit, Buddha Handhaltung Bedeutung, Halte Durch - Englisch,

Kategorien: Startseite

Schreibe einen Kommentar

Deine E-Mail-Adresse wird nicht veröffentlicht. Erforderliche Felder sind mit * markiert.